PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5606966 to PF01458 (UPF0051)

VIMSS5606966 has 447 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.6e-74  234.9   0.5    5.7e-74  234.6   0.5    1.1  1  VIMSS5606966  


Domain annotation for each sequence (and alignments):
>> VIMSS5606966  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  234.6   0.5   5.7e-74   5.7e-74       3     218 .]     185     408 ..     183     408 .. 0.95

  Alignments for each domain:
  == domain 1  score: 234.6 bits;  conditional E-value: 5.7e-74
       UPF0051   3 fertlivveegaevtii..eey......agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgega 91 
                   + r+li+++++ae++++  e+       +   vveif++en+++ ++ +++ s+++  +++++++++++++++++ +++ ++ltr+++ ++l+gega
  VIMSS5606966 185 NRRLLIILGKDAEASLLicEHTldthsfLVTEVVEIFAAENSRFALYDLEESSKNTKRIASVHVRQAANSNVTINCMTIHNGLTRNNYYCHLEGEGA 281
                   67999**********9944222443344444****************************************************************** PP

       UPF0051  92 eaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAt 188
                   +++l g+++a+gkqh+d+ ++++h +pn++s+ l+k +l+ +a++ f g+i+v+kgaqkt a+q+nrnLll+d+ar++++P+lei+addvk+sHg t
  VIMSS5606966 282 DLTLGGMAIAEGKQHVDNYSRIEHLVPNCQSNELFKYILSRQAQGAFSGRIYVAKGAQKTAAYQNNRNLLLDDTARMYSKPQLEIYADDVKCSHGMT 378
                   ************************************************************************************************* PP

       UPF0051 189 vGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +G++d+++lfYL++RG++ +eA+ ++  +f
  VIMSS5606966 379 TGQLDDDALFYLRQRGIPLAEAKTMLSVAF 408
                   *************************98877 PP



Or compare VIMSS5606966 to CDD or PaperBLAST