PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5780346 to PF01458 (UPF0051)

VIMSS5780346 has 445 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      1e-57  181.4   0.0    1.3e-57  181.1   0.0    1.1  1  VIMSS5780346  


Domain annotation for each sequence (and alignments):
>> VIMSS5780346  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  181.1   0.0   1.3e-57   1.3e-57       2     218 .]     194     417 ..     193     417 .. 0.95

  Alignments for each domain:
  == domain 1  score: 181.1 bits;  conditional E-value: 1.3e-57
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   q+++++i++e + e ++i   +gc            +++e +++++Ak++++ +qnw e ++  + +ra+ g++a++  ttv lg + +   +  + 
  VIMSS5780346 194 QAPHIIIIAERNTEFHLI---EGCtapvlvrhslhlDMTEAYIHDGAKVQLTVLQNWPEYVHTRPMTRARIGKNARFINTTVGLGTGRSNIANPKYW 287
                   899***************...788888888888888*************************************************996655555556 PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                    +e++ +elng++l++++ ++d++ ++ ++g+++ +   sk+v+ de++++ rgki   ++a +t++h+++++Ll+sdka ++t P l  + dd+++
  VIMSS5780346 288 VEENGYVELNGIILGQKDWYVDLGGEMYLQGREAAGINASKAVIMDESTVITRGKI--VAEAPRTKGHISCDALLMSDKAVMETYPGLVSRVDDAEL 382
                   67******************************************************..555************************************ PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   sH+A++Gki ee+lfYLmsRGlsee+A++liv+gf
  VIMSS5780346 383 SHEAAIGKIREEELFYLMSRGLSEEKATQLIVKGF 417
                   **********************************9 PP



Or compare VIMSS5780346 to CDD or PaperBLAST