PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5780670 to PF01458 (UPF0051)

VIMSS5780670 has 475 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.1e-68  215.4   0.0    5.1e-68  215.1   0.0    1.1  1  VIMSS5780670  


Domain annotation for each sequence (and alignments):
>> VIMSS5780670  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.1   0.0   5.1e-68   5.1e-68       2     218 .]     219     444 ..     218     444 .. 0.97

  Alignments for each domain:
  == domain 1  score: 215.1 bits;  conditional E-value: 5.1e-68
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfe+tl+v++eg+ +++i   +gc            g+vei+++++A++k++++qnws++++n+++kra  +++a +e++++s+g+k+t+++ps++l
  VIMSS5780670 219 QFEHTLLVADEGSYIHFI---EGCsapmykgfsfhdGMVEIYAHKGATVKFTTIQNWSRNVINFNNKRAIIEENAYVEWIEGSIGSKITYTYPSSVL 312
                   89****************...666666666777777*********************************9999************************ PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   kgega++  + + l++g    dt+ k  h +pntss+i+sk+++++++ +++rg +++ kga+++ a +++++L+l+++++a+t P+ + d+  + +
  VIMSS5780670 313 KGEGARTAQYVVSLSNGPFMKDTGAKTWHLAPNTSSKIVSKSISANGGINIYRGLVRILKGAKNSTATVSCDSLILDEESKAYTYPHNQNDEPSASI 409
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                    H+At+Gk+ e++lfY++sRG+ eeeA++liv gf
  VIMSS5780670 410 IHEATTGKLGEDKLFYMNSRGIGEEEAKSLIVLGF 444
                   *********************************99 PP



Or compare VIMSS5780670 to CDD or PaperBLAST