PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5916697 to PF01458 (UPF0051)

VIMSS5916697 has 392 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.6e-75  239.6   0.0    2.7e-75  238.9   0.0    1.3  1  VIMSS5916697  


Domain annotation for each sequence (and alignments):
>> VIMSS5916697  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  238.9   0.0   2.7e-75   2.7e-75       5     218 .]     137     362 ..     133     362 .. 0.98

  Alignments for each domain:
  == domain 1  score: 238.9 bits;  conditional E-value: 2.7e-75
       UPF0051   5 rtlivveegaevtiieey....agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeaelng 97 
                    + i+ve+ga++ +  +y    ++ ++ve++vg+nA+l++++  +w+ dav+ls++ a++grda+l++t +++gg+++r  p+v+++++g++ae+ g
  VIMSS5916697 137 AISIEVEAGADAIVALQYvgsgTHADNVEFIVGDNARLTVITDTHWNADAVHLSNQLAQLGRDATLRHTVATFGGEVVRIVPRVRFTAPGGDAEMLG 233
                   5679***********9998887777************************************************************************ PP

       UPF0051  98 lylakgkqhldtrtkvdhngpntssrilskgvlkd.......earavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvk.asHg 186
                   +y+a+++q++++r++vdh++pn++s++l+kg+l++       +ar+++ g++++r +a++td+++ nr+L+l+++arad+iP+lei+++++  a+H+
  VIMSS5916697 234 VYFADDGQYFEQRLLVDHAVPNCRSNVLYKGALQGdknsdkpDARTCWVGDVLIRSNAHGTDTYEANRSLVLTEGARADAIPNLEIETGQIVgAGHA 330
                   ************************************************************************************************* PP

       UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   AtvG++d+e++fYL++RG++ eeArrlivrgf
  VIMSS5916697 331 ATVGRFDDEHVFYLQARGIPAEEARRLIVRGF 362
                   *******************************9 PP



Or compare VIMSS5916697 to CDD or PaperBLAST