PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5916698 to PF01458 (UPF0051)

VIMSS5916698 has 481 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.1e-77  245.8   0.2    2.9e-77  245.4   0.2    1.2  1  VIMSS5916698  


Domain annotation for each sequence (and alignments):
>> VIMSS5916698  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  245.4   0.2   2.9e-77   2.9e-77       2     218 .]     227     452 ..     226     452 .. 0.97

  Alignments for each domain:
  == domain 1  score: 245.4 bits;  conditional E-value: 2.9e-77
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfertli+v+e+a v+++   +gc            +vvei+v+++ +++y+++qnws++++nl+tkr+++++  ++e++++++g+k+t+k+p v +
  VIMSS5916698 227 QFERTLIIVDEDAYVHYV---EGCtapiyksdslhsAVVEIIVKKGGRCRYTTIQNWSNNVYNLVTKRTKVEEGGTMEWVDGNIGSKVTMKYPAVWM 320
                   89****************...777777777777777*************************************9*********************** PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   +g++a++e+ ++++a+++q++dt+ k++h +p tss+i+sk+v+++++ra +rg ++++++a+++ +++e+++Ll++d +r+dt P+  i++d v +
  VIMSS5916698 321 TGPHAKGEVLSVAFAGEGQFQDTGAKMTHMAPYTSSNIVSKSVARGGGRAAYRGLVQINANAHHSTSNVECDALLVDDISRSDTYPYNDIRNDHVSL 417
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+Atv++++eeqlfYLmsRGl eeeA+++ivrgf
  VIMSS5916698 418 GHEATVSQVSEEQLFYLMSRGLAEEEAMAMIVRGF 452
                   **********************************9 PP



Or compare VIMSS5916698 to CDD or PaperBLAST