PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS613313 to PF01458 (UPF0051)

VIMSS613313 has 482 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.2e-78  247.3   0.3    9.8e-78  246.9   0.3    1.2  1  VIMSS613313  


Domain annotation for each sequence (and alignments):
>> VIMSS613313  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  246.9   0.3   9.8e-78   9.8e-78       2     218 .]     228     453 ..     227     453 .. 0.97

  Alignments for each domain:
  == domain 1  score: 246.9 bits;  conditional E-value: 9.8e-78
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+ega v+++   +gc            +vvei+v++nA+++y+++qnws++++nl+t+ra +++  ++e++++++g+k ++k+p ++l 
  VIMSS613313 228 QFERTLIIVDEGAYVHYV---EGCtapiyksdslhaAVVEIIVKKNARCRYTTIQNWSNNVYNLVTQRAYVEEGGTMEWIDGNIGSKANMKYPACYLM 322
                  89****************...777777777777777*********************************999999*********************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  g++a++e  ++++a+++qh+dt+ k+ h++p tss+i+sk+++++++r+ +rg + v k+a+++++ +++++Ll++d +r+dt P+  i++d+v + H
  VIMSS613313 323 GPHAKGEALSVAFAAEGQHQDTGAKMVHKAPYTSSTIVSKSISQGGGRSAYRGLVSVGKDAHHSSSAVRCDALLVDDISRSDTYPYNDIRTDEVSMAH 420
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +Atv+k++e+qlfYLm+RGl+eeeA+++ivrgf
  VIMSS613313 421 EATVSKVSEDQLFYLMQRGLTEEEAMAMIVRGF 453
                  ********************************9 PP



Or compare VIMSS613313 to CDD or PaperBLAST