PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS664827 to PF01458 (UPF0051)

VIMSS664827 has 464 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.9e-76  240.8   0.4    9.2e-76  240.4   0.4    1.2  1  VIMSS664827  


Domain annotation for each sequence (and alignments):
>> VIMSS664827  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  240.4   0.4   9.2e-76   9.2e-76       2     218 .]     210     435 ..     209     435 .. 0.97

  Alignments for each domain:
  == domain 1  score: 240.4 bits;  conditional E-value: 9.2e-76
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+e+a+v+++   +gc            +vvei+v+ +A ++y+++qnw+++++nl+tkr+ ++++a++e++++++g+klt+k+p v+l+
  VIMSS664827 210 QFERTLIIVDENASVNYV---EGCtapvyttnslhsAVVEIIVKPGAYCRYTTIQNWANNVYNLVTKRTFCEENATMEWIDGNIGSKLTMKYPAVHLR 304
                  89****************...666666666667777*********************************99*************************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  gega+++  ++++a+++q++d + k+ h +pntss+i+sk+++k+++++++rg +++ ++a ++++++e+++L++++ +++dtiP+ ei + ++ ++H
  VIMSS664827 305 GEGARGTTLSIAIAGKGQRQDAGAKMMHYAPNTSSTIVSKSISKQGGNVTYRGIVHFGRNADGARSNIECDTLIMDNLSTSDTIPYNEILNSNISLEH 402
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +A v+k++eeqlfYLmsRGlseeeA+++iv gf
  VIMSS664827 403 EAKVSKVSEEQLFYLMSRGLSEEEATEMIVMGF 435
                  ********************************9 PP



Or compare VIMSS664827 to CDD or PaperBLAST