PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6843659 to PF01458 (UPF0051)

VIMSS6843659 has 469 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.8e-78  248.2   0.1      5e-78  247.8   0.1    1.1  1  VIMSS6843659  


Domain annotation for each sequence (and alignments):
>> VIMSS6843659  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  247.8   0.1     5e-78     5e-78       2     218 .]     215     440 ..     214     440 .. 0.97

  Alignments for each domain:
  == domain 1  score: 247.8 bits;  conditional E-value: 5e-78
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfe+tli+v+ega++++i   +gc            g ve++v+e+A+l+y++++nws++++nl+tkra +++d ++e++++s+g+++++ +p + l
  VIMSS6843659 215 QFEHTLIIVDEGAKLHFI---EGCsapkysvtnlhaGCVELYVKEGATLRYSTIENWSKNMLNLNTKRAIVEKDGTIEWVSGSFGSQISMLYPMSIL 308
                   89****************...666666777777777*********************************99************************** PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   kgega+ae++g+ +a+++q+ldt+ kv+h++pntss+i+sk++++++++a++rg +kv+ +a ++++ +++++L+l++k+++dtiP +   +ddv++
  VIMSS6843659 309 KGEGARAEFTGVSFAGKGQNLDTGAKVIHAAPNTSSTINSKSISRNGGKATYRGVLKVNSNAYNSKSMVSCESLMLDNKSKSDTIPVIDLLNDDVEI 405
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+A +Gki+++ +fYLm+RG+se+eA+++ivrgf
  VIMSS6843659 406 GHEAKIGKISDDSIFYLMTRGISEDEAKSMIVRGF 440
                   **********************************9 PP



Or compare VIMSS6843659 to CDD or PaperBLAST