PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6843660 to PF01458 (UPF0051)

VIMSS6843660 has 365 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.5e-63  198.7   1.3    7.7e-63  198.2   1.3    1.1  1  VIMSS6843660  


Domain annotation for each sequence (and alignments):
>> VIMSS6843660  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  198.2   1.3   7.7e-63   7.7e-63       5     217 ..     116     336 ..     112     337 .. 0.97

  Alignments for each domain:
  == domain 1  score: 198.2 bits;  conditional E-value: 7.7e-63
       UPF0051   5 rtlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                   +++iv ee+++++ii +y         ++g+ +i+ ++n+++k++kv+  +e++v+++++  + ++d k+++++v lgg+ ++ +++ +l g+++ a
  VIMSS6843660 116 NLIIVGEENSKASIIVKYkslddsngYHNGICTIYSKKNSEIKLTKVNFLNENTVHFDSNVSDIEEDGKVDFISVDLGGQYSIYNYHGDLIGDKSAA 212
                   4568999********99999999999889*******************************9999********************************* PP

       UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvG 190
                   ++n++yl+++++ +d+++ v+h+g++++s+i++kg+l+++ar+ f+g+++++ ga+k+ + +++ +++ls++ara+++P l + +ddv  +H+A+ G
  VIMSS6843660 213 NINSIYLGSKDKLIDINYIVTHKGQRSNSNINVKGALQGKARKAFKGTLDFKTGASKSVGAEDEYCMILSKEARAKAMPVLLCAEDDVSGEHAASSG 309
                   ************************************************************************************************* PP

       UPF0051 191 kideeqlfYLmsRGlseeeArrlivrg 217
                   +ide++lfYLmsRGls +eA+ +ivr+
  VIMSS6843660 310 RIDENKLFYLMSRGLSYDEAKIVIVRA 336
                   *************************97 PP



Or compare VIMSS6843660 to CDD or PaperBLAST