PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6860543 to PF01458 (UPF0051)

VIMSS6860543 has 344 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.9e-55  172.0   0.1    9.6e-55  171.7   0.1    1.1  1  VIMSS6860543  


Domain annotation for each sequence (and alignments):
>> VIMSS6860543  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  171.7   0.1   9.6e-55   9.6e-55       2     218 .]     101     323 ..     100     323 .. 0.95

  Alignments for each domain:
  == domain 1  score: 171.7 bits;  conditional E-value: 9.6e-55
       UPF0051   2 qfertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                   +f +t++ +++ga+v++   +              +i+vgenA +++   +   +  + + + ++++++ a++++ ++    ++ r +++++lkgeg
  VIMSS6860543 101 DFGHTVLDIGKGAKVSLE--IldnkvthdIAAERFDINVGENADVEIFFANPACDLPLRFRHFNINQAAGANVRFSSICKDTAIGRVSVECHLKGEG 195
                   57799**********888..2123344453349***************999999999**************************************** PP

       UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgA 187
                   a+++ ++l +++g+  +++r+++ h++p+t+s++l+++ l+++ar++++g + v  ++++ +++q  +++lls++a+++ +P l+i++ddv+++Hg 
  VIMSS6860543 196 ANFDYRSLHVLDGEASQHSRLTIYHEAPRTTSTQLARNLLSGSARVSYDGSVIVGYDCTGVNSSQLVNTILLSEDASVSVKPVLKIYHDDVECTHGN 292
                   ************************************************************************************************* PP

       UPF0051 188 tvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   tvG++d+eq+fYL sRG++++ A+++++r+f
  VIMSS6860543 293 TVGELDAEQMFYLVSRGIPKKAAQEMLMRSF 323
                   *****************************98 PP



Or compare VIMSS6860543 to CDD or PaperBLAST