PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS704 to PF01458 (UPF0051)

VIMSS704 has 395 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    5.6e-55  172.5   0.0    7.3e-55  172.1   0.0    1.1  1  VIMSS704  


Domain annotation for each sequence (and alignments):
>> VIMSS704  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  172.1   0.0   7.3e-55   7.3e-55       3     218 .]     155     374 ..     153     374 .. 0.92

  Alignments for each domain:
  == domain 1  score: 172.1 bits;  conditional E-value: 7.3e-55
   UPF0051   3 fertlivveegaevtiieeyagc..........gvveifvgenAklkyvkvqnw..sedavnlstkraeegrdaklelttvslggkltrkepsvelkgega 91 
                +++++v+++ga ++i    +g+          g++ +f+ge+A+l ++++      e+++  +++++e ++ ++l +++ s+g++  r+  s+ lkge+a
  VIMSS704 155 VPYIVFVLGKGAAISIE---MGMsalpdnvylfGKTLCFLGEEAELVLTMKPLPkgTERIIWAHHVEVERRGACALIQDMRSMGKGWFRN--SFFLKGETA 250
               57899************...7777778888888*************99966544326677777777778788**************6666..********* PP

   UPF0051  92 eaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGki 192
               ++e   ++l+++  +l ++++++h++++t+sr++++++l++++  +f+g i+++++ + ++a+q++++Llls++a+a+t+P+lei +ddvkasHgAtvG++
  VIMSS704 251 HGESLVKVLGGD--FLGVHNTMHHDDRETTSRQNIRSILEEGS-FSFEGGIHISPRGTLSNAYQKHDTLLLSNRASASTFPRLEILTDDVKASHGATVGSL 348
               *********999..**************************877.********************************************************* PP

   UPF0051 193 deeqlfYLmsRGlseeeArrlivrgf 218
               ++  l+YL+sRG+s  eA++ + ++f
  VIMSS704 349 NAYLLTYLRSRGFSLIEAKQALQKSF 374
               **********************9998 PP



Or compare VIMSS704 to CDD or PaperBLAST