PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7233609 to PF01458 (UPF0051)

VIMSS7233609 has 476 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.8e-77  246.0   0.5    2.4e-77  245.6   0.5    1.2  1  VIMSS7233609  


Domain annotation for each sequence (and alignments):
>> VIMSS7233609  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  245.6   0.5   2.4e-77   2.4e-77       2     218 .]     222     447 ..     221     447 .. 0.97

  Alignments for each domain:
  == domain 1  score: 245.6 bits;  conditional E-value: 2.4e-77
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfe+tli++eeg+ev++i   +gc            g ve+fvge+A+++y++vqnws++++nl+tkra  ++  ++e++++s+g+k t+ +ps+ l
  VIMSS7233609 222 QFEHTLIIAEEGSEVHYI---EGCsapkysafnlhsGGVEVFVGEDAHVQYSTVQNWSKNTYNLNTKRAIAEKGGRMEWISGSMGSKATMLYPSTIL 315
                   89****************...666666777777777*********************************8888999********************* PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   kg+ga+ +  ++++a+++q +dt+ kv hn+pnt+s++ sk+++kd++r+ +rg ++++ ga+++++ +e+++L++++k+++dt+P++ei++ +v +
  VIMSS7233609 316 KGRGASDNHITIAFAGEGQDIDTGAKVYHNAPNTKSTVESKSIAKDGGRTNYRGLVHIADGAENSSTAVECDALMFDNKSTSDTMPYMEINESKVDV 412
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                    H+AtvGki +e +fYL+sRGl+ ++A+++iv gf
  VIMSS7233609 413 AHEATVGKIGDEDIFYLQSRGLDDDDAKQMIVSGF 447
                   **********************************9 PP



Or compare VIMSS7233609 to CDD or PaperBLAST