PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS912386 to PF01458 (UPF0051)

VIMSS912386 has 435 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-62  195.1   1.7    1.1e-61  194.5   1.7    1.3  1  VIMSS912386  


Domain annotation for each sequence (and alignments):
>> VIMSS912386  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.5   1.7   1.1e-61   1.1e-61       3     218 .]     184     408 ..     182     408 .. 0.94

  Alignments for each domain:
  == domain 1  score: 194.5 bits;  conditional E-value: 1.1e-61
      UPF0051   3 fertlivveegaevtiieey......agc...gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgega 91 
                  +++++iv ee aevt++e+y      +g+    ++e+++g+n++++y +v++ +++++    +r   ++da++++  + ++++ ++ +++++l g+++
  VIMSS912386 184 YNHVIIVTEESAEVTYVENYlsnasgEGNqlnIISEVIAGANSNITYGSVDYMDKGFTGHIIRRGITEADASINWALGLMNEGSQIIDNTTNLFGDRS 281
                  6799****************877766222666*********************9977766666666699***************************** PP

      UPF0051  92 eaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtv 189
                  +++l+++++++g+q++++++k+   g++t + il +gv+k++a +vf+g  ++++g +k+ a+qe+r+L+ls++ar d++P+l id+ddv+a+H+A+v
  VIMSS912386 282 TSSLKSVVVGTGEQKINLTSKIVQYGKETDGYILKHGVMKEHASSVFNGIGYIKHGGTKSIANQESRVLMLSEHARGDANPILLIDEDDVQAGHAASV 379
                  ************************************************************************************************** PP

      UPF0051 190 GkideeqlfYLmsRGlseeeArrlivrgf 218
                  G++d +ql+YLmsRG+s++eA+rl+++gf
  VIMSS912386 380 GRVDPDQLYYLMSRGISQREAERLVIHGF 408
                  ****************************9 PP



Or compare VIMSS912386 to CDD or PaperBLAST