PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS912389 to PF01458 (UPF0051)

VIMSS912389 has 465 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.8e-79  250.3   0.7    1.2e-78  249.8   0.7    1.2  1  VIMSS912389  


Domain annotation for each sequence (and alignments):
>> VIMSS912389  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  249.8   0.7   1.2e-78   1.2e-78       2     218 .]     211     436 ..     210     436 .. 0.97

  Alignments for each domain:
  == domain 1  score: 249.8 bits;  conditional E-value: 1.2e-78
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+++ega+v+++   +gc            +vvei+v+++A+++y+++qnw+++++nl+tkr+ + ++ ++e+++++lg+klt+k+p+++l 
  VIMSS912389 211 QFERTLIIADEGASVHYV---EGCtapvyttsslhsAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYPNCVLL 305
                  89****************...666667777777777*********************************9999999********************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  gega+++  ++++a+++q +d + k++h++pntss+i+sk+++k+++++++rg +++ ++a+++++++e+++L+l++++++dtiP+ e+++d++ ++H
  VIMSS912389 306 GEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIVHFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEH 403
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +A v+k++eeqlfYLmsRG+seeeA+++iv gf
  VIMSS912389 404 EAKVSKVSEEQLFYLMSRGISEEEATEMIVMGF 436
                  ********************************9 PP



Or compare VIMSS912389 to CDD or PaperBLAST