PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS942440 to PF01458 (UPF0051)

VIMSS942440 has 468 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.7e-75  238.9   0.0    3.4e-75  238.6   0.0    1.1  1  VIMSS942440  


Domain annotation for each sequence (and alignments):
>> VIMSS942440  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  238.6   0.0   3.4e-75   3.4e-75       2     218 .]     214     439 ..     213     439 .. 0.97

  Alignments for each domain:
  == domain 1  score: 238.6 bits;  conditional E-value: 3.4e-75
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+egaev++i   +gc            gv+ei+v+++A+ +y+++qnws +++nl+t+ra + +da  e+++++lg+k+t+k+ps++l 
  VIMSS942440 214 QFERTLIIVDEGAEVHYI---EGCtapmysteslhtGVIEIVVKRGARSRYTTIQNWSTNMYNLVTQRALVYGDAYHEWVDGNLGSKVTMKYPSSYLL 308
                  89****************...666667777777777**********************************9*************************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  ++ga++e+ ++++ak +qh+dt+ k+++++p+ts++i+sk+++k+++ra++rg +kv +ga + + ++e+++Ll+++++r dt P++ei+++ ++++H
  VIMSS942440 309 EPGARSEILSIAFAKTGQHQDTGGKLILAAPHTSGTIVSKSISKGKGRASYRGLVKVMEGARHGKVNVECDALLIDPESRTDTYPYIEIEEETAHVGH 406
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +Atv+ki++eq+fYL+sRGl+e+eA +livrgf
  VIMSS942440 407 EATVSKINDEQIFYLQSRGLKEDEAAALIVRGF 439
                  ********************************9 PP



Or compare VIMSS942440 to CDD or PaperBLAST