PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS942441 to PF01458 (UPF0051)

VIMSS942441 has 431 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.8e-72  228.0   0.0    7.2e-72  227.7   0.0    1.1  1  VIMSS942441  


Domain annotation for each sequence (and alignments):
>> VIMSS942441  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.7   0.0   7.2e-72   7.2e-72       5     217 ..     183     403 ..     179     404 .. 0.97

  Alignments for each domain:
  == domain 1  score: 227.7 bits;  conditional E-value: 7.2e-72
      UPF0051   5 rtlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeae 94 
                  r l+ +e++a++ +ieey        ++ + +e+++  +A+l++  vq+ +e++++++++ra ++rd+ l+   v+lgg+ +r+e+ +el g+gae+e
  VIMSS942441 183 RSLLFLEDNAKAAYIEEYlsldlpptLHLSATEMVLRPGARLRHAHVQTFGEGVWHFHRQRALLERDSGLNDLVVNLGGAYARSEVASELVGPGAESE 280
                  77899*************98888888666********************************************************************* PP

      UPF0051  95 lnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGki 192
                  + gly+++g+q++d+ t+ +h + +t+s++l+kg++kdearavf g i+ +kgaqktda+q nrnLlls++ar+d+iP+lei a+dv+++Hg+t+  +
  VIMSS942441 281 MLGLYFGHGRQQFDHYTLQHHVEHHTRSDLLYKGAVKDEARAVFSGLIRLEKGAQKTDAYQANRNLLLSPTARVDSIPQLEIGANDVRCTHGSTTAPV 378
                  ************************************************************************************************** PP

      UPF0051 193 deeqlfYLmsRGlseeeArrlivrg 217
                  de qlfYL+sRGl++  A++l+v++
  VIMSS942441 379 DEMQLFYLQSRGLPRGLAQELLVKA 403
                  ***********************97 PP



Or compare VIMSS942441 to CDD or PaperBLAST