PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003638484.1 to PF01458 (UPF0051)

WP_003638484.1 has 433 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.7e-59  186.6   3.6    3.7e-59  186.1   3.6    1.1  1  WP_003638484.1  


Domain annotation for each sequence (and alignments):
>> WP_003638484.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  186.1   3.6   3.7e-59   3.7e-59       4     218 .]     180     402 ..     178     402 .. 0.97

  Alignments for each domain:
  == domain 1  score: 186.1 bits;  conditional E-value: 3.7e-59
         UPF0051   4 ertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                      ++liv+e++++  + +++          + vvei +  +++++y+  ++ + +++ + ++ra   r ak+++  + +++++t  ++++el geg
  WP_003638484.1 180 SHVLIVAEADSHFAVTQHLttkgdvtnIANCVVEILARGDSEVHYSAFDELGANTTAYLNRRASISRGAKVDWAIGMMNNGNTFGDFDSELIGEG 274
                     699*************888887776664459**************************************************************** PP

         UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                     a+++ + +++++++q + ++t+v+ +g++t ++i+ +gv+ ++++ +f+g  ++ +ga++++a+qenr+L++sd+a+ d++P+l id++dv a+H
  WP_003638484.1 275 AKSDAKVITVTTKSQDVCINTRVTNRGKKTDGNIVQRGVIMEKSNLIFNGIGHIIHGASGAHAEQENRVLMMSDDAHGDANPILLIDENDVLAGH 369
                     *********************************************************************************************** PP

         UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     +A+vG+id++q++YLmsRG+++++A+rl++rgf
  WP_003638484.1 370 AASVGQIDQNQMYYLMSRGIDKAQAQRLVIRGF 402
                     ********************************9 PP



Or compare WP_003638484.1 to CDD or PaperBLAST