PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003638487.1 to PF01458 (UPF0051)

WP_003638487.1 has 468 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-76  242.9   2.9    2.2e-76  242.4   2.9    1.2  1  WP_003638487.1  


Domain annotation for each sequence (and alignments):
>> WP_003638487.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  242.4   2.9   2.2e-76   2.2e-76       2     218 .]     214     439 ..     213     439 .. 0.97

  Alignments for each domain:
  == domain 1  score: 242.4 bits;  conditional E-value: 2.2e-76
         UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsv 84 
                     qfertli+ve+ga+v ++   +gc            +vve++v+ nA ++y+++qnws++++ l+tkra  +++a++e+++++lg+k+t+k+psv
  WP_003638487.1 214 QFERTLIIVEDGASVDYV---EGCtapnyssdslhaAVVEVNVEPNAYCRYTTIQNWSDNVYSLETKRAAAAENATMEWVDGNLGSKVTMKYPSV 305
                     89****************...666777777777777**********************************9************************ PP

         UPF0051  85 elkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179
                     +l+gega++++ ++++a+++ h+d++ +++hn++ntss i+sk+++k ++ + +rg+++++k++ +++ah+e+++++++d+++++tiP+ eid  
  WP_003638487.1 306 YLNGEGARGTMLSIAVASNGIHQDSGARMIHNAKNTSSSIVSKSIAKTGGATDYRGTVRFAKHSDGSKAHVECDTIIMDDQSSSNTIPYNEIDSA 400
                     *********************************************************************************************** PP

         UPF0051 180 dvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     +v ++H+A v+ki+eeql+YLmsRG+se++A+++i+ gf
  WP_003638487.1 401 NVAMEHEAKVSKISEEQLYYLMSRGISEAKATEMIIMGF 439
                     **************************************9 PP



Or compare WP_003638487.1 to CDD or PaperBLAST