PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003829250.1 to PF01458 (UPF0051)

WP_003829250.1 has 499 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.5e-75  239.0   0.0    3.4e-75  238.6   0.0    1.2  1  WP_003829250.1  


Domain annotation for each sequence (and alignments):
>> WP_003829250.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  238.6   0.0   3.4e-75   3.4e-75       2     218 .]     245     470 ..     244     470 .. 0.97

  Alignments for each domain:
  == domain 1  score: 238.6 bits;  conditional E-value: 3.4e-75
         UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsv 84 
                     qfertli+++eg+ v+++   +gc            ++vei+v+++A+++y++vqnws++++nl+t+ra +++  ++e++++++g+k t+k+p +
  WP_003829250.1 245 QFERTLIIADEGSYVHYV---EGCtapiwsedslhaAIVEIIVEKHARVRYTTVQNWSNNVYNLVTQRAYVREGGTMEWVDGNIGSKATMKYPAC 336
                     89****************...667777777777777*********************************9999999******************* PP

         UPF0051  85 elkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179
                      l+++ a+a+  +l +a+++q++dt+ k++h +p+tss+i++k+++++++r+ +rg +k+ kga ++++++ +++Ll++d +r+dt P++ +++d
  WP_003829250.1 337 ILAEPYAKASTMSLGFAGKGQYQDTGAKMIHLAPHTSSTIVAKSISRGGGRSAYRGLVKIVKGAYGSSNSTVCDALLVDDFSRSDTYPHVDVRED 431
                     *********************************************************************************************** PP

         UPF0051 180 dvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     dv + H+Atv+ki+e+qlfYLmsRGl+eeeAr +ivrgf
  WP_003829250.1 432 DVSMAHEATVSKISEDQLFYLMSRGLTEEEARGMIVRGF 470
                     **************************************9 PP



Or compare WP_003829250.1 to CDD or PaperBLAST