PaperBLAST – Find papers about a protein or its homologs

 

Align WP_004920521.1 to PF01458 (UPF0051)

WP_004920521.1 has 481 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.9e-72  228.6   0.0    5.3e-72  228.1   0.0    1.2  1  WP_004920521.1  


Domain annotation for each sequence (and alignments):
>> WP_004920521.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  228.1   0.0   5.3e-72   5.3e-72       2     218 .]     220     452 ..     219     452 .. 0.97

  Alignments for each domain:
  == domain 1  score: 228.1 bits;  conditional E-value: 5.3e-72
         UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraeegrdaklelttvslggkl 77 
                     qfertl+v++eg+ v+++   +gc            +vve+++ e+A++ky++vqnw       +++++n++tkr  +++dak+++t+v++g+++
  WP_004920521.1 220 QFERTLVVADEGSYVSYL---EGCtapsrdenqlhaAVVELIAMEGAEIKYSTVQNWypgdesgKGGVFNFVTKRGLCEKDAKISWTQVETGSAV 311
                     89****************...666667777777777**************************9777**********99***************** PP

         UPF0051  78 trkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiP 172
                     t+k+ps+ lkg+++ +e++++++++++q +dt+tk++h g+nt+s+i+skg++++++++++rg +kv + a++++++ ++++Ll+++++ a+t+P
  WP_004920521.1 312 TWKYPSCILKGDNSIGEFYSIAVTNNHQWADTGTKMIHIGKNTKSTIISKGISAGKSNNSYRGLVKVMPSAKGARNFSQCDSLLMGNECGAHTFP 406
                     *********************************************************************************************** PP

         UPF0051 173 eleidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     ++ei+   ++++H+At++ki e+q+fY+++RGl+ e+A +liv+gf
  WP_004920521.1 407 YIEIKDPSAQLEHEATTSKIGEDQIFYCNQRGLDTEKAIALIVNGF 452
                     *********************************************9 PP



Or compare WP_004920521.1 to CDD or PaperBLAST