PaperBLAST – Find papers about a protein or its homologs

 

Align WP_004920546.1 to PF01458 (UPF0051)

WP_004920546.1 has 427 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-80  256.3   0.7    1.7e-80  255.9   0.7    1.1  1  WP_004920546.1  


Domain annotation for each sequence (and alignments):
>> WP_004920546.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  255.9   0.7   1.7e-80   1.7e-80       2     218 .]     172     396 ..     171     396 .. 0.99

  Alignments for each domain:
  == domain 1  score: 255.9 bits;  conditional E-value: 1.7e-80
         UPF0051   2 qfertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkg 88 
                     +++r+++vve+g+++++ie++        ++++ +eif + nAk +  k+qn  ++++ ++++ ++++rd+  +++t+s+ggkl+r+++++ ++g
  WP_004920546.1 172 YNPRNILVVEAGSQIEVIESHhnfdtsftFTNSLTEIFTKPNAKADWHKLQNDTDTSYLVDHTFVKQERDSLATVNTFSFGGKLVRNNLDFIQEG 266
                     589****************999*999999999*************************************************************** PP

         UPF0051  89 egaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                     e+ ++ +ng+++ +++q +d++t v+hn+pn++s +++kgv kd+a++vf+gk+ v k aqkt+a+q+n+n+lls++a++d++P+lei+addvk+
  WP_004920546.1 267 ENINSFMNGITIIGKDQLVDHHTAVHHNQPNCESYQNYKGVFKDNAHGVFNGKVFVDKIAQKTNAYQQNNNILLSEGATIDSKPQLEIFADDVKC 361
                     *********************************************************************************************** PP

         UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     sHg+tvG+++e++lfYL++RG+s++eA++l++++f
  WP_004920546.1 362 SHGCTVGQLNEDALFYLRARGISKNEAQALLLYAF 396
                     *********************************99 PP



Or compare WP_004920546.1 to CDD or PaperBLAST