PaperBLAST – Find papers about a protein or its homologs

 

Align WP_007052146.1 to PF01458 (UPF0051)

WP_007052146.1 has 411 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.5e-65  207.0   0.0    2.1e-65  206.6   0.0    1.1  1  WP_007052146.1  


Domain annotation for each sequence (and alignments):
>> WP_007052146.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  206.6   0.0   2.1e-65   2.1e-65       5     218 .]     152     371 ..     149     371 .. 0.96

  Alignments for each domain:
  == domain 1  score: 206.6 bits;  conditional E-value: 2.1e-65
         UPF0051   5 rtlivveegaevtiieey......agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                     +++i + ++a++ ++ e+      a    vei  g++++++ + vq+w+++a +++++r+++g+ a+l++  v+lgg+++r +++ ++ ge++++
  WP_007052146.1 152 HLVIAAADKAHADVVVEHdgdarlA--EGVEITTGKDSHVSTTFVQEWAKTAKHVANHRIHVGEGASLRHSVVTLGGDIVRIRMDQDFGGEQGDL 244
                     7889999999999998887776433..99****************************************************************** PP

         UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkd.earavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvk.asHg 186
                     ++ g+y+++ ++h+++rt v hn+p+++sr+++kg+l++ +a++++ g+ ++++ a +td+++ nrnL+l+++a ad+ P+lei+++++  a+H+
  WP_007052146.1 245 NMLGIYFVDPGEHIEHRTMVVHNHPDCKSRVVYKGALDGkGAHSTWVGNALIQPTAPGTDSYELNRNLVLTPGAIADSEPNLEIENGNIIgAGHA 339
                     ***************************************556***************************************************** PP

         UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     ++vG++d+e+lfYL+sRG++e +Ar+l+vrgf
  WP_007052146.1 340 SSVGRFDDEELFYLESRGIPETDARKLVVRGF 371
                     *******************************9 PP



Or compare WP_007052146.1 to CDD or PaperBLAST