PaperBLAST – Find papers about a protein or its homologs

 

Align WP_077395669.1 to PF01458 (UPF0051)

WP_077395669.1 has 399 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-67  213.9   1.0    1.5e-67  213.6   1.0    1.1  1  WP_077395669.1  


Domain annotation for each sequence (and alignments):
>> WP_077395669.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  213.6   1.0   1.5e-67   1.5e-67       3     218 .]     153     374 ..     151     374 .. 0.97

  Alignments for each domain:
  == domain 1  score: 213.6 bits;  conditional E-value: 1.5e-67
         UPF0051   3 fertlivveegaevtiieey......agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgega 91 
                     + ++ i +ee+a++++++        +++  ++++ +++A++++++ q +s++a  l    a+ g++++++++t++ gg+l+r+e+ ++l+g+ +
  WP_077395669.1 153 HLHHSITLEEDARLSLLDIQlgegqyLTNPQMDVHCADKAHFSHITHQAESREAARLGIISARIGERSNYDSFTLNQGGALARQEVVSQLSGPFS 247
                     56889************444666666888****************************************************************** PP

         UPF0051  92 eaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHg 186
                     ++++n + l++g++  d+ + ++h+ p+++sr+++++vl++++++vf+gki+v + aqktd++q n++Llls+ka+++++Pelei+addvk+sHg
  WP_077395669.1 248 NTNVNAIQLVDGSRLNDLSSMIHHASPDCTSRQTVRTVLSENGQGVFQGKILVDQIAQKTDGYQMNQALLLSEKAQMNSKPELEIYADDVKCSHG 342
                     *********************************************************************************************** PP

         UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                     AtvG +de+qlfYL+sRG+ ee+Ar+++v++f
  WP_077395669.1 343 ATVGALDEDQLFYLRSRGVLEEQARDMLVQAF 374
                     ******************************99 PP



Or compare WP_077395669.1 to CDD or PaperBLAST