PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001347720.1 to PF01458 (UPF0051)

XP_001347720.1 has 1462 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-48  152.0   0.2      1e-48  152.0   0.2    2.6  3  XP_001347720.1  


Domain annotation for each sequence (and alignments):
>> XP_001347720.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.4   0.1      0.17      0.17      41      67 ..     875     902 ..     846     922 .. 0.75
   2 ?   -3.6   0.9       0.4       0.4      79     125 ..    1092    1139 ..    1066    1144 .. 0.68
   3 !  152.0   0.2     1e-48     1e-48       3     218 .]    1205    1429 ..    1203    1429 .. 0.96

  Alignments for each domain:
  == domain 1  score: -2.4 bits;  conditional E-value: 0.17
         UPF0051  41 vkvqnwsedavnlstkra.eegrdakle 67 
                     +k q+ s++a+n++++++ +++r+ k  
  XP_001347720.1 875 IKNQDISNNAYNFNKEHIdKCKRKYKKA 902
                     56677799*******9995557754444 PP

  == domain 2  score: -3.6 bits;  conditional E-value: 0.4
         UPF0051   79 rkepsvelkgegaeaelnglylakgkq.hldtrtkvdhngpntssril 125 
                       ++++ ++ +++++ ++++ + +++kq + +++++ + ++ n+s +++
  XP_001347720.1 1092 DNNNDNDIYEKQSKYNVYENIPSNNKQtNSNNNSEYNNEQNNCSNKQI 1139
                      455666666777777777777777776456666677777777776665 PP

  == domain 3  score: 152.0 bits;  conditional E-value: 1e-48
         UPF0051    3 fertlivveegaevtiieey.........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86  
                      ++r++++v+ +++++i e++         + +g ++i ++e++++k++  q+ ++++++++++ +++g +a++++++v lg+  +r ++++e 
  XP_001347720.1 1205 NPRLVVYVKGNSKINIYESHislnksnsgLVNGFSRICLEEKSNVKHTLSQELGNNVWHFHNVSVKNGLNANYKFVDVLLGSLSSRINLQIEG 1297
                      799*****************999887777667**********************************999*****************9777775 PP

         UPF0051   87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179 
                      + +g++ e +gl l+++kq++ +    +h++p  ++++l+k+ ++d+a+av+r++ +++++a k++ ++ ++++ll+ +a+a  iP lei   
  XP_001347720.1 1298 E-KGCKQESYGLSLLEDKQNISQYEMFHHEHPSMETNQLFKCLVSDKAHAVWRSRGRIERNAIKAKLNTLCKSILLNFGASAVCIPTLEIIPS 1389
                      4.99***************************************************************************************** PP

         UPF0051  180 dvk.asHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218 
                      d++ a+HgAt++ +++e +f Lm+RG+se+ Ar++++++f
  XP_001347720.1 1390 DIEcANHGATISDLEKEPIFSLMTRGISERNAREIMMNSF 1429
                      ***99********************************998 PP



Or compare XP_001347720.1 to CDD or PaperBLAST