PaperBLAST – Find papers about a protein or its homologs

 

Align XP_022713037.1 to PF01458 (UPF0051)

XP_022713037.1 has 1340 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    6.1e-47  146.2   1.1    6.1e-47  146.2   1.1    2.6  3  XP_022713037.1  


Domain annotation for each sequence (and alignments):
>> XP_022713037.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.8   0.1      0.12      0.12      65     120 ..      94     149 ..      61     153 .. 0.82
   2 ?   -3.4   0.1      0.36      0.36     107     134 ..     473     501 ..     470     518 .. 0.75
   3 !  146.2   1.1   6.1e-47   6.1e-47       3     218 .]    1075    1299 ..    1073    1299 .. 0.96

  Alignments for each domain:
  == domain 1  score: -1.8 bits;  conditional E-value: 0.12
         UPF0051  65 klelttvslggkltrkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpnt 120
                     k e++ + +g++l  k+ +  ++ ++ +  + ++y +k+k++ + ++  +h ++++
  XP_022713037.1  94 KNEIHIIHFGNGLHEKYENLPIENNNYNEIIISKYNTKNKENTEKDLYTKHINKRC 149
                     44677888999999999999999999999999999999999999999999999988 PP

  == domain 2  score: -3.4 bits;  conditional E-value: 0.36
         UPF0051 107 ldtrtkvdhngpnts.srilskgvlkdea 134
                     l+t++ ++hn+ nt+ s +++   +++++
  XP_022713037.1 473 LNTHNSLKHNNNNTKpSSQKYEERSSQDS 501
                     68899999999999978887776655555 PP

  == domain 3  score: 146.2 bits;  conditional E-value: 6.1e-47
         UPF0051    3 fertlivveegaevtiieey.........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86  
                      ++r++++++e+++++i e++         + ++ ++i++++n+k++++  q+ +++a+ ++++ +++g +++++++++ lg+  +r ++++e 
  XP_022713037.1 1075 NPRLVLYIKENSKINIHESHislnnnnggMVNALSRIYLEQNSKVNHILSQELGKSAWYFHNVSVQNGINSNYKFVDILLGSLSSRVNLQIEG 1167
                      7899*****************99888777777**********************************999******************777776 PP

         UPF0051   87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179 
                      + +g++ + +gl l++gkq++ +    +h++   ++++l+k+ ++d+a++v+r++ +++++a k++ ++ +r+ ll+ +a+a +iP lei   
  XP_022713037.1 1168 S-QGSKQQSYGLSLLEGKQNISQYEMFHHEHSSMQTDQLFKSLVSDTAHSVWRSRGRIERNAIKAKLNTLCRSVLLNLGASAVAIPTLEIIPS 1259
                      5.9****************************************************************************************** PP

         UPF0051  180 dvk.asHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218 
                      d++ a+HgAt++ ++ee +f LmsRG++ + Arr+++++f
  XP_022713037.1 1260 DIEeANHGATISDLEEEPIFSLMSRGIDTNIARRIMMKAF 1299
                      **************************************99 PP



Or compare XP_022713037.1 to CDD or PaperBLAST