PaperBLAST – Find papers about a protein or its homologs

 

Align YP_008686537.1 to PF01458 (UPF0051)

YP_008686537.1 has 427 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.4e-63  199.8   0.1      3e-63  199.5   0.1    1.1  1  YP_008686537.1  


Domain annotation for each sequence (and alignments):
>> YP_008686537.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.5   0.1     3e-63     3e-63       5     218 .]     180     397 ..     176     397 .. 0.96

  Alignments for each domain:
  == domain 1  score: 199.5 bits;  conditional E-value: 3e-63
         UPF0051   5 rtlivveegaevtiieey....agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeael 95 
                     ++ i+ve+ga+vt++e+         v+e+ v+e+ ++++++ q  ++d    ++  a+++++  ++++t++ +g +tr+e  +el g++a a++
  YP_008686537.1 180 HHCIRVEPGADVTVLENGpaaaRFTKVMEVDVAEGGRFHHIRAQGRDHDRRASTHIFARVAGKGLFKSFTLTANGVMTRNEAVIELVGDEAVAHV 274
                     788************8888665223*******************88888888888888999********************************** PP

         UPF0051  96 nglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvG 190
                      g+++++gk h d ++ v+h+g+ ++sr+++k vlk++a++vf+gki+v++gaqktd++q +++Lll++++   ++Pelei+addvk+sHg+t G
  YP_008686537.1 275 AGAAVGDGKFHHDDTVFVTHEGEACESRQVFKKVLKNGATGVFQGKILVKPGAQKTDGYQISQSLLLDEDSVFLAKPELEIYADDVKCSHGSTSG 369
                     *********************************************************************************************** PP

         UPF0051 191 kideeqlfYLmsRGlseeeArrlivrgf 218
                      ide  lfYL+sRG++ + A++l+v +f
  YP_008686537.1 370 AIDETGLFYLRSRGVPLKAAQSLLVLAF 397
                     *************************998 PP



Or compare YP_008686537.1 to CDD or PaperBLAST