PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001309670.1 to PF01595 (DUF21)

NP_001309670.1 has 797 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-41  128.6   0.4      3e-41  127.2   0.4    1.7  1  NP_001309670.1  


Domain annotation for each sequence (and alignments):
>> NP_001309670.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.2   0.4     3e-41     3e-41       2     169 ..     203     366 ..     202     374 .. 0.90

  Alignments for each domain:
  == domain 1  score: 127.2 bits;  conditional E-value: 3e-41
           DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgk....kkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvi 92 
                      +++ll++s++fsg++++l++ls+ +l+   ++g+    + a r+l+++k+ ++lL+tllign +vn++ s+l++ l+++ +a        ++v+
  NP_001309670.1 203 CLLILLCFSGLFSGLNLGLMTLSPYELQLYIASGTeqekRDAGRILPIRKKGNQLLCTLLIGNVVVNVGVSLLMDQLVGSGFA--------VLVA 289
                     568899*********************65555555333377778*********************************999986........4555 PP

           DUF21  93 vtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseee 169
                      t  i+vfgEi+P++l++k  ++i ++++p+++vl++l+yPl+w++sk+l+++l++e +  + ++ l +++++se++
  NP_001309670.1 290 ATSCIVVFGEIIPQALCVKLGLPIGARTIPITQVLLFLMYPLTWPISKVLDIFLKEELTRSLERNKLVEMLKLSEKS 366
                     6************************************************************************9987 PP



Or compare NP_001309670.1 to CDD or PaperBLAST