PaperBLAST – Find papers about a protein or its homologs

 

Align NP_064569.3 to PF01595 (DUF21)

NP_064569.3 has 775 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.2e-39  119.9   0.9    8.8e-39  119.1   0.9    1.3  1  NP_064569.3  


Domain annotation for each sequence (and alignments):
>> NP_064569.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.1   0.9   8.8e-39   8.8e-39       1     176 []     187     358 ..     187     358 .. 0.92

  Alignments for each domain:
  == domain 1  score: 119.1 bits;  conditional E-value: 8.8e-39
        DUF21   1 liivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivt 94 
                  l+i +ll+ls++fsg++++l++l++++l    +   ek++++a+++++++++ + lL++ll+gn lvn+ l++l++ l+++ l         a++  t
  NP_064569.3 187 LLITVLLVLSGIFSGLNLGLMALDPMELrivqNCGTEKERRYARKIEPIRRKGNYLLCSLLLGNVLVNTSLTILLDNLIGSGLM--------AVASST 276
                  57899999********************88876667777799**********************************99888773........45555* PP

        DUF21  95 llilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                  + i++fgEilP++l+ ++ +++ + ++ +++++m l++Pl++++skll+++l++e ++++++e l ++++++e  +++ +ee
  NP_064569.3 277 IGIVIFGEILPQALCSRHGLAVGANTILLTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEPYNDLVKEE 358
                  ***********************************************************************99888886665 PP



Or compare NP_064569.3 to CDD or PaperBLAST