PaperBLAST – Find papers about a protein or its homologs

 

Align NP_291048.2 to PF01595 (DUF21)

NP_291048.2 has 771 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      3e-39  120.7   0.9      6e-39  119.7   0.9    1.4  1  NP_291048.2  


Domain annotation for each sequence (and alignments):
>> NP_291048.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.7   0.9     6e-39     6e-39       1     176 []     184     355 ..     184     355 .. 0.92

  Alignments for each domain:
  == domain 1  score: 119.7 bits;  conditional E-value: 6e-39
        DUF21   1 liivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivt 94 
                  l++++ll+ls++fsg++++l++l++++l    +   ek++k+a+++++++++ + lL++ll+gn lvn+ l++l++ l+++ +        +a++  t
  NP_291048.2 184 LLVMVLLVLSGIFSGLNLGLMALDPMELrivqNCGTEKERKYARKIEPIRRKGNYLLCSLLLGNVLVNTSLTILLDNLIGSGI--------MAVASST 273
                  5779999*********************8887666777779**********************************99988866........344555* PP

        DUF21  95 llilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                  + i++fgEilP++l+ ++ +++ + ++++++v+m l++Pl++++skll+++l++e ++++++e l ++++++e  +++ +ee
  NP_291048.2 274 IGIVIFGEILPQALCSRHGLAVGANTIVLTKVFMLLTFPLSFPISKLLDFVLGQEIRTVYNREKLMEMLKVTEPYNDLVKEE 355
                  ***********************************************************************99888886665 PP



Or compare NP_291048.2 to CDD or PaperBLAST