PaperBLAST – Find papers about a protein or its homologs

 

Align NP_503052.1 to PF01595 (DUF21)

NP_503052.1 has 811 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.6e-37  113.5   0.6    8.4e-37  112.7   0.6    1.4  1  NP_503052.1  


Domain annotation for each sequence (and alignments):
>> NP_503052.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.7   0.6   8.4e-37   8.4e-37       5     168 ..     210     367 ..     206     375 .. 0.93

  Alignments for each domain:
  == domain 1  score: 112.7 bits;  conditional E-value: 8.4e-37
        DUF21   5 lllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatviv.tlli 97 
                  +ll+lsa+fsg++++l+sl + +l    ++ a k++k a+++l+++k+ + lL++ll+gn +vn ++s+l++ l + ++a          +i  t+ i
  NP_503052.1 210 FLLCLSALFSGLTLGLMSLTPQELelviKSGAIKEQKCAAKILPVRKKGNLLLCSLLLGNVIVNSAISILMGELTTGIYA----------LIGsTMGI 297
                  899*********************888877777778******************************************97..........5555**** PP

        DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveesee 168
                  ++fgEilP+s+++k+ +++ + ++ +++++++l++P++w++skll+++l +++ +a++++ l +l+++s  
  NP_503052.1 298 VIFGEILPQSICVKKGLEVGAHTISITQLFIFLTFPIAWPVSKLLDCLL-GDEYQAYDRKRLMELIKMSIT 367
                  *************************************************.8***************99865 PP



Or compare NP_503052.1 to CDD or PaperBLAST