Q7UQW5 has 415 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-29 86.7 2.1 1.4e-28 85.8 2.1 1.4 1 Q7UQW5 Domain annotation for each sequence (and alignments): >> Q7UQW5 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.8 2.1 1.4e-28 1.4e-28 2 174 .. 13 179 .. 12 186 .. 0.93 Alignments for each domain: == domain 1 score: 85.8 bits; conditional E-value: 1.4e-28 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvfGEil 104 ++l+l+++s++fs++E+Al+sl++ + + ++g + + + ll++p+rlL+++l+ n l+n+ +l++ + a+l +g i+t+++ l i++f+E+l Q7UQW5 13 AMLVLIVASGLFSGSEAALFSLKERDRKRIGRNG-APGRVVTLLLAEPDRLLAAILFWNLLINMTYFTLVAIVSADLSRPG-----IFTLVCLLTIIFFSEML 109 56899********************988888887.67889*************************************9865.....999999*********** PP CNNM 105 PktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseee 174 Pk++a+ + +ial+v +p+ + + +++P++ ++++ ++ rll e ep++ +++ +e+++ Q7UQW5 110 PKSFAVMTPTRIALMVGVPMTIAVGIVSPILPFVKWANEAAGRLLWPTFEPEPEIELTDIERAIELGTDD 179 ******************************************99999999**********9999998765 PP
Or compare Q7UQW5 to CDD or PaperBLAST