Q84R21 has 653 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-53 165.2 6.8 9.7e-53 164.6 6.8 1.3 1 Q84R21 Domain annotation for each sequence (and alignments): >> Q84R21 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 164.6 6.8 9.7e-53 9.7e-53 1 181 [] 158 335 .. 158 335 .. 0.98 Alignments for each domain: == domain 1 score: 164.6 bits; conditional E-value: 9.7e-53 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvfGEi 103 li+++ll lsaffs+aEt++++l + +++elaek+ ++ + l+++ +r+L+t+lig t+vni+++al+t++++ ++ g+++v +at+++t++il+++Ei Q84R21 158 LILAVLLGLSAFFSMAETSITTLWPWKVRELAEKE-PENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTKAATAIF--GEAGVSAATGVMTVAILLLTEI 257 578999***************************97.99999**************************************..799******************* PP CNNM 104 lPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieeee 181 +Pk++a++na+++a +v++p+ +ls++lyP+ +++++l+ +il++lG k+++ep+vte+el+ +++ +e +G+ieeee Q84R21 258 TPKSVAVHNAQEVARIVVRPVAWLSLILYPVGRVVTYLSMGILKILGLKGRSEPYVTEDELKLMLRGAELSGAIEEEE 335 ***************************************************************************998 PP
Or compare Q84R21 to CDD or PaperBLAST