PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P0C588 to PF01595 (DUF21)

SwissProt::P0C588 has 772 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.6e-39  120.1   1.0    8.4e-39  119.2   1.0    1.4  1  SwissProt::P0C588  


Domain annotation for each sequence (and alignments):
>> SwissProt::P0C588  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  119.2   1.0   8.4e-39   8.4e-39       1     176 []     185     356 ..     185     356 .. 0.92

  Alignments for each domain:
  == domain 1  score: 119.2 bits;  conditional E-value: 8.4e-39
              DUF21   1 liivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavvi 88 
                        l++++ll+ls++fsg++++l++l++++l    +   ek++++a+++++++++ + lL++ll+gn lvn+ l++l++ l+++ +        +
  SwissProt::P0C588 185 LLVLVLLVLSGIFSGLNLGLMALDPMELrivqNCGTEKERRYARKIEPIRRKGNYLLCSLLLGNVLVNTSLTILLDNLIGSGI--------M 268
                        5778999*********************88876667777799*********************************99988866........3 PP

              DUF21  89 atvivtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                        a++  t+ i++fgEilP++l+ ++ +++ + ++++++++m l++Pl++++skll+++l++e ++++++e l ++++++e  +++ +ee
  SwissProt::P0C588 269 AVASSTIGIVIFGEILPQALCSRHGLAVGANTIVLTKIFMLLTFPLSFPISKLLDFVLGQEIRTVYNREKLMEMLKVTEPYNDLVKEE 356
                        44555************************************************************************99888886665 PP



Or compare SwissProt::P0C588 to CDD or PaperBLAST