PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q3TWN3 to PF01595 (DUF21)

SwissProt::Q3TWN3 has 875 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      8e-41  125.8   0.1    1.4e-40  125.0   0.1    1.3  1  SwissProt::Q3TWN3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q3TWN3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.0   0.1   1.4e-40   1.4e-40       2     176 .]     261     431 ..     260     431 .. 0.92

  Alignments for each domain:
  == domain 1  score: 125.0 bits;  conditional E-value: 1.4e-40
              DUF21   2 iivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavvia 89 
                        +i lll+ls++fsg++++l++l++++l    +   ek+k +akr+++++++ + lL++ll+gn lvn+ l++l+++++++ l        +a
  SwissProt::Q3TWN3 261 FISLLLCLSGMFSGLNLGLMALDPMELrivqNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGL--------VA 344
                        567899*********************8887566667778*************************************99977........45 PP

              DUF21  90 tvivtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                        +v+ t+ i++fgEi+P++++ ++ +++ + ++ +++++m+ ++P+++++skll+++l++e ++++++e l +++++++  +++ +ee
  SwissProt::Q3TWN3 345 VVVSTIGIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPYNDLVKEE 431
                        5555***********************************************************************998887776665 PP



Or compare SwissProt::Q3TWN3 to CDD or PaperBLAST