PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10349430 to PF01595 (DUF21)

VIMSS10349430 has 419 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.1e-55  174.2   8.3    2.3e-55  173.2   8.3    1.4  1  VIMSS10349430  


Domain annotation for each sequence (and alignments):
>> VIMSS10349430  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  173.2   8.3   2.3e-55   2.3e-55       1     169 [.       8     181 ..       8     196 .. 0.97

  Alignments for each domain:
  == domain 1  score: 173.2 bits;  conditional E-value: 2.3e-55
          DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtll 96 
                    +ii++l+++saffs++EtA+++l++ +l++la+k++++akr l+l++nperlL+++lignt++ni++++++++  ++ +  g+l+++iat++vt+l
  VIMSS10349430   8 IIIFILICISAFFSSSETAMIALNKYKLKHLAKKNHRAAKRSLSLVRNPERLLVAILIGNTFANIFAGTVISSYSEDHF--GDLGLLIATIVVTIL 101
                    789****************************************************************************..69************* PP

          DUF21  97 ilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklveeseee 169
                    +lvfgEi+Pks+a+ y++++a+ ++ pl+++m +lyP+v++ls+++++ l       e+ +++ +++ee++++v+es+++
  VIMSS10349430 102 VLVFGEIIPKSFAAIYPQRLAFPFSLPLKIIMLILYPAVIFLSMVSKVTLklfgvkiEAVNNESLDKEEIQTVVNESNAK 181
                    *****************************************************************************987 PP



Or compare VIMSS10349430 to CDD or PaperBLAST