PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS11867 to PF01595 (DUF21)

VIMSS11867 has 346 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.2e-48  150.4   2.4    3.9e-48  149.6   2.4    1.3  1  VIMSS11867  


Domain annotation for each sequence (and alignments):
>> VIMSS11867  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  149.6   2.4   3.9e-48   3.9e-48       2     176 .]       7     179 ..       6     180 .. 0.97

  Alignments for each domain:
  == domain 1  score: 149.6 bits;  conditional E-value: 3.9e-48
       DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvf 100
                 +i+++ll+s+++s+aE+Al+s+  +++++l+++++++a +l+ ++++ +r + t++++n++ ni+ s+ ++al+++ l  +++++ ++  i+tlli+vf
  VIMSS11867   7 AIFIVLLGSGICSCAEAALFSVPLVKVRQLSQSNNPSAIALQAIRHRMNRPIGTIVVLNNIFNIVGSITIGALATKHL--QDAWMGVFSGILTLLIIVF 103
                 4678889***********************************************************************..689**************** PP

       DUF21 101 gEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                 gEi+Pk+l+ +ya  ial++a p+r+l+ +++Plvwl+++++n ++++++ p ++e+e+k l +++++egvie +e
  VIMSS11867 104 GEIIPKTLGERYATNIALLIAIPVRFLTLIFTPLVWLIEQITNPFTHGKRVPSTNEAEIKFLATLGYKEGVIEGDE 179
                 ************************************************************************8766 PP



Or compare VIMSS11867 to CDD or PaperBLAST