PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS149990 to PF01595 (DUF21)

VIMSS149990 has 398 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-45  141.2   1.2    2.2e-45  140.7   1.2    1.2  1  VIMSS149990  


Domain annotation for each sequence (and alignments):
>> VIMSS149990  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.7   1.2   2.2e-45   2.2e-45      21     169 ..       1     154 [.       1     161 [. 0.96

  Alignments for each domain:
  == domain 1  score: 140.7 bits;  conditional E-value: 2.2e-45
        DUF21  21 vslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEilPkslalkyaekial 118
                  ++l+r rl+++a++g+++akr++kll++p+rl+s +lign+lvnil+sal+t + ++l+  g+++v+iat ++t+++lvf+E+lPk++a+ y+ek+a 
  VIMSS149990   1 MTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLY--GDAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAY 96 
                  689********************************************************..69*********************************** PP

        DUF21 119 alapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklveeseee 169
                   ++ +l  l++l++Plvwll+ +++l++           +  +s+eel+++v es+++
  VIMSS149990  97 PSSFLLAPLQILMMPLVWLLNTITRLLMrlmgiktDIVVSGSLSKEELRTIVHESRSQ 154
                  *******************************998866678899************987 PP



Or compare VIMSS149990 to CDD or PaperBLAST