PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS184628 to PF01595 (DUF21)

VIMSS184628 has 421 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-62  195.8   4.7      4e-62  195.2   4.7    1.2  1  VIMSS184628  


Domain annotation for each sequence (and alignments):
>> VIMSS184628  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.2   4.7     4e-62     4e-62       2     176 .]      10     188 ..       9     188 .. 0.98

  Alignments for each domain:
  == domain 1  score: 195.2 bits;  conditional E-value: 4e-62
        DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilv 99 
                  ++++l++ls+ffs++EtAl++lsr+r++++++++ k+ak l+kll++p++lL  +lign++vni++s+la++l+ +++  g+ +v++at ++t+l+l+
  VIMSS184628  10 LLIILIILSGFFSASETALMALSRIRVRHMVDEEIKGAKLLEKLLEDPNKLLGGILIGNNIVNIGASSLASTLAFRIF--GDGGVALATGVMTILVLI 105
                  679999************************************************************************..578*************** PP

        DUF21 100 fgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseeegvieeee 176
                  fgEi+Pksla+++aek++la+ap++ ++ ++++Plvwl+s ++ li+       ++sep+++eeelk++v++seeegv+e ee
  VIMSS184628 106 FGEITPKSLAKQNAEKVSLAVAPIINIVVTVFKPLVWLFSSVSSLIVrllggdLNKSEPFITEEELKTMVDVSEEEGVLEVEE 188
                  *****************************************************99************************9987 PP



Or compare VIMSS184628 to CDD or PaperBLAST