PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1938021 to PF01595 (DUF21)

VIMSS1938021 has 434 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.7e-35  107.0   0.7    6.7e-35  106.5   0.7    1.2  1  VIMSS1938021  


Domain annotation for each sequence (and alignments):
>> VIMSS1938021  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.5   0.7   6.7e-35   6.7e-35       3     176 .]       9     185 ..       7     185 .. 0.98

  Alignments for each domain:
  == domain 1  score: 106.5 bits;  conditional E-value: 6.7e-35
         DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilv 99 
                   +v+l++++ + ++aE++l ++s++r ee +++g+++ ++l ++ ++p r+L+++l++   ++++++al+t++  + +  ++ a++ia+++++ll  v
  VIMSS1938021   9 AVALVVVAWLAACAEAGLARVSSFRAEEAVRSGRRGGEKLAQVAADPTRYLNVALLVRVACEMAAAALVTYACLRQFDGTGEALIIAIAVMVLLSYV 105
                   68999*******************************************************************9999999999*************** PP

         DUF21 100 fgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil...esesepavseeelkklveeseeegvieeee 176
                      + P+++++++++ +a+a a++l  l +++ P+  ll ++ n+++   + +++p+ se+el++lv+++e+e  ie+ee
  VIMSS1938021 106 AVGVSPRTIGRQHPLNTATAAAYVLLPLARIMGPIPSLLILIGNALTpgkGFRRGPFASEAELRALVDYAEKESLIEAEE 185
                   **************************************************99************************9997 PP



Or compare VIMSS1938021 to CDD or PaperBLAST