PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS200529 to PF01595 (DUF21)

VIMSS200529 has 423 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-49  153.7   7.2    3.3e-49  153.1   7.2    1.2  1  VIMSS200529  


Domain annotation for each sequence (and alignments):
>> VIMSS200529  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  153.1   7.2   3.3e-49   3.3e-49       2     166 ..      12     180 ..      10     186 .. 0.97

  Alignments for each domain:
  == domain 1  score: 153.1 bits;  conditional E-value: 3.3e-49
        DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilv 99 
                  ++++l+l+sa+fsg+EtA+++l+r rl++la +g+k+a r+lkll++p+rl+  +lign+lvnil++++at + ++l+  g+l+v+ia  ++tl++lv
  VIMSS200529  12 FLLVLILFSAYFSGSETAMMTLNRYRLRHLASNGHKGAIRALKLLERPDRLIGLILIGNNLVNILAASIATIIGMRLW--GDLGVAIASGVLTLVVLV 107
                  557788************************************************************************..69**************** PP

        DUF21 100 fgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklvees 166
                  fgE++Pk++a+ ++e+ia+ ++++l  l+++++ +v  ++ ++ +il      +  s++a+s+eel+++v e+
  VIMSS200529 108 FGEVTPKTIAALNPERIAFPSSYLLIALSKIFAYVVTSVNFITTGILrlvgikSISSSDALSKEELRTVVHEA 180
                  ****************************************************9999*************9986 PP



Or compare VIMSS200529 to CDD or PaperBLAST