PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2093006 to PF01595 (DUF21)

VIMSS2093006 has 419 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.2e-56  175.6   8.1    8.4e-56  174.6   8.1    1.4  1  VIMSS2093006  


Domain annotation for each sequence (and alignments):
>> VIMSS2093006  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  174.6   8.1   8.4e-56   8.4e-56       1     169 [.       8     181 ..       8     196 .. 0.97

  Alignments for each domain:
  == domain 1  score: 174.6 bits;  conditional E-value: 8.4e-56
         DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtlli 97 
                   +ii++l+++saffs++EtA+++l++ +l++la+k++++akr l+l++nperlL+++lignt++ni++++++++  ++ +  g+l+++iat++vt+l+
  VIMSS2093006   8 IIIFILICISAFFSSSETAMMALNKYKLKHLAKKNHRAAKRSLSLVRNPERLLVAILIGNTFANIFAGTVISSYSEDHF--GDLGLLIATIVVTILV 102
                   789****************************************************************************..69************** PP

         DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklveeseee 169
                   lvfgEi+Pks+a+ y++++a+ ++ pl+++m +lyP+v++ls+++++ l       e+ +++ +++ee++++v+es+++
  VIMSS2093006 103 LVFGEIIPKSFAAIYPQRLAFPFSLPLKIIMLILYPAVIFLSMVSKVTLklfgvkiEAVNNESLDKEEIQTVVNESNAK 181
                   ****************************************************************************987 PP



Or compare VIMSS2093006 to CDD or PaperBLAST