PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS25848 to PF01595 (DUF21)

VIMSS25848 has 407 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.8e-37  113.0   3.0    9.5e-37  112.5   3.0    1.2  1  VIMSS25848  


Domain annotation for each sequence (and alignments):
>> VIMSS25848  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  112.5   3.0   9.5e-37   9.5e-37       9     175 ..       2     172 ..       1     173 [. 0.94

  Alignments for each domain:
  == domain 1  score: 112.5 bits;  conditional E-value: 9.5e-37
       DUF21   9 lsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEilPks 107
                 ls +fs+aEtA+ +l++lrl+ l ek++++a+ ++++l++ +++L++++igntl++ +lsa++++++  l++    av +++ + t+l+l+fgEi+Pks
  VIMSS25848   2 LSMLFSAAETAFCALNTLRLRYLYEKRHARARVAMRILRRKNFYLAAVVIGNTLASSALSAVIALFARALFGI--HAVGWSIGAGTVLTLLFGEIIPKS 98 
                 899********************************************************************75..5999999999************** PP

       DUF21 108 lalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseeegvieee 175
                 lal ++ ++al +a++l++    l+P+v ++ +   ++l       +  +  v++++l +++ ++e+ g++ ++
  VIMSS25848  99 LALCRPNAVALHTARFLQWSALMLTPFVQVFCMARSALLrlarvaCHTPSLRVTDDDLHTVLYAGEADGTVTSR 172
                 ****************************998888888888899997788999*************999998665 PP



Or compare VIMSS25848 to CDD or PaperBLAST