PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS25849 to PF01595 (DUF21)

VIMSS25849 has 453 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
      8e-47  145.3   1.1    1.1e-46  144.9   1.1    1.2  1  VIMSS25849  


Domain annotation for each sequence (and alignments):
>> VIMSS25849  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  144.9   1.1   1.1e-46   1.1e-46       3     176 .]      11     185 ..       9     185 .. 0.94

  Alignments for each domain:
  == domain 1  score: 144.9 bits;  conditional E-value: 1.1e-46
       DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfg 101
                 +++ll++sa+++g+E Al+s+++ + ++l++++++ ++rl +ll+++e+l++t+++ nt  n++ls+++t+  +el+  ga +v+ a+v+vt++i+++g
  VIMSS25849  11 LMFLLVCSALCAGSESALSSVNQDDERKLKRHSTRCTQRLCWLLARREQLITTVIVQNTALNMVLSSVVTLGSMELW--GAQSVWKALVAVTCVIILCG 107
                 5899*************************************************************************..689***************** PP

       DUF21 102 EilPkslalkyaekialalapplrvlmvllyPlvwl...lskllnlilesesepavseeelkklveeseeegvieeee 176
                 E++Pk+l+++y++ +++++ap+l++ ++llyP++++   l+++l++i   ++++ +s+ee+k+l++++++egvi+++e
  VIMSS25849 108 EMFPKALGARYSLGFLMWIAPFLQLSYWLLYPCACVssaLMHVLEGIFLPRHTTCLSREEIKTLIAVGAREGVISSTE 185
                 **********************************9944455555555599************************9876 PP



Or compare VIMSS25849 to CDD or PaperBLAST