PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS261 to PF01595 (DUF21)

VIMSS261 has 404 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.2e-33  102.5   0.3    2.2e-33  101.6   0.3    1.4  1  VIMSS261  


Domain annotation for each sequence (and alignments):
>> VIMSS261  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  101.6   0.3   2.2e-33   2.2e-33       4     172 ..      14     184 ..      11     188 .. 0.92

  Alignments for each domain:
  == domain 1  score: 101.6 bits;  conditional E-value: 2.2e-33
     DUF21   4 vlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEil 104
               +l++++ +ffs++E+A +s +r+rl+    k++kka+ +  l+++p rl  t+++g++++   +++  + + ++ll+   ++   a +   +l+++f+E++
  VIMSS261  14 LLCIFVQGFFSMMEMACISFNRVRLQYYLTKSNKKASYINFLVRRPYRLFGTVMLGVNIAL-QIGSESSRTCYKLLG---ISPEYAPATQIILVVIFAELI 110
               6899******************************************************985.566677777799997...45555555559********** PP

     DUF21 105 PkslalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseeegvi 172
               P ++ +k +ekial+ ap+l+++++l+yPl+  ++ ++n i       e+  ++++s++el+k +e ++ee ++
  VIMSS261 111 PLAISRKIPEKIALKGAPILYFAHYLFYPLIQCVGGITNMIYfilnikEETLHSTLSRDELQKTLETHHEEHDF 184
               ************************************************99********************9876 PP



Or compare VIMSS261 to CDD or PaperBLAST