PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS261016 to PF01595 (DUF21)

VIMSS261016 has 346 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-50  157.2   5.0    2.9e-50  156.5   5.0    1.2  1  VIMSS261016  


Domain annotation for each sequence (and alignments):
>> VIMSS261016  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.5   5.0   2.9e-50   2.9e-50       1     174 [.       3     177 ..       3     179 .. 0.98

  Alignments for each domain:
  == domain 1  score: 156.5 bits;  conditional E-value: 2.9e-50
        DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllil 98 
                  ++i++l+++s ffsg+EtAl+++++++ ++ a+kg+kkak + kll++p+++++t+lign+++nill++l+t ++ ++     ++v ia +++t++i+
  VIMSS261016   3 IAIIILIFISFFFSGSETALTAANKTKFKTEADKGDKKAKGIVKLLEKPSEFITTILIGNNVANILLPTLVTIMALRWG----ISVGIASAVLTVVII 96 
                  6789**********************************************************************99997....89************* PP

        DUF21  99 vfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.....esesepavseeelkklveeseeegviee 174
                  +++E++Pks+a+ +++ki +++ p++ ++ ++++P++ ll+kl++ i      ++ +e+++s+ee k++++++ +eg+++e
  VIMSS261016  97 LISEVIPKSVAATFPDKITRLVYPIINICVIVFRPITLLLNKLTDSINrslskGQPQEHQFSKEEFKTMLAIAGHEGALNE 177
                  *****************************************************99**********************9987 PP



Or compare VIMSS261016 to CDD or PaperBLAST