VIMSS341424 has 375 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-33 101.2 3.6 4.3e-33 100.6 3.6 1.3 1 VIMSS341424 Domain annotation for each sequence (and alignments): >> VIMSS341424 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.6 3.6 4.3e-33 4.3e-33 4 180 .. 9 177 .. 6 178 .. 0.95 Alignments for each domain: == domain 1 score: 100.6 bits; conditional E-value: 4.3e-33 CNNM 4 llllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvfG 101 + + +s ++s +E+ l+s+s++ + +l ++g++ a++l kl+++ +r L+++l +nt++ ++ +a a+a +a ++ g+ a+ i+ +++tl+ilv++ VIMSS341424 9 SIAIGISFICSVLEAVLLSISPSYIAQLNQQGHPAAEQLSKLKSDIDRPLASILTLNTIAHTIGAATAGAQAAVVF--GSEALGIFSAVLTLAILVLS 104 577899**********************************************************************..56789999999********* PP CNNM 102 EilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieee 180 Ei+Pkt+++ + ++a a a+ lr+ ++ l+P+vw+ +++++ + +++e ++el ++ +++e+G++ e VIMSS341424 105 EIVPKTIGATYWRQLAPAAAVSLRWMVWALTPFVWFSEQITKRLA------RNHEAPKMRDELSAMAILARESGEFAEG 177 *********************************************......7888888899*************99775 PP
Or compare VIMSS341424 to CDD or PaperBLAST