PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS341424 to PF01595 (DUF21)

VIMSS341424 has 375 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-34  105.6   3.4    2.1e-34  104.9   3.4    1.3  1  VIMSS341424  


Domain annotation for each sequence (and alignments):
>> VIMSS341424  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  104.9   3.4   2.1e-34   2.1e-34       4     175 ..       9     177 ..       6     178 .. 0.95

  Alignments for each domain:
  == domain 1  score: 104.9 bits;  conditional E-value: 2.1e-34
        DUF21   4 vlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfg 101
                   + +++s ++s +E+ l+s+s++ + +l ++g+++a++l kl ++ +r L+++l +nt++ ++ +a a+a ++ +++  + a+ i+ +++tl+ilv++
  VIMSS341424   9 SIAIGISFICSVLEAVLLSISPSYIAQLNQQGHPAAEQLSKLKSDIDRPLASILTLNTIAHTIGAATAGAQAAVVFG--SEALGIFSAVLTLAILVLS 104
                  57889***********************************************************************5..7799999999********* PP

        DUF21 102 EilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieee 175
                  Ei+Pk++++ y  ++a a a+ lr+  + l+P+vw+ +++++ +  +++e +  ++el ++  +++e+g++ e 
  VIMSS341424 105 EIVPKTIGATYWRQLAPAAAVSLRWMVWALTPFVWFSEQITKRLA-RNHEAPKMRDELSAMAILARESGEFAEG 177
                  *********************************************.788888889**************99765 PP



Or compare VIMSS341424 to CDD or PaperBLAST