PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS369699 to PF01595 (DUF21)

VIMSS369699 has 445 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-43  134.7  10.7    2.2e-43  134.2  10.7    1.2  1  VIMSS369699  


Domain annotation for each sequence (and alignments):
>> VIMSS369699  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  134.2  10.7   2.2e-43   2.2e-43       2     176 .]      31     205 ..      30     205 .. 0.93

  Alignments for each domain:
  == domain 1  score: 134.2 bits;  conditional E-value: 2.2e-43
        DUF21   2 iivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtl 95 
                  +i+l+l++s +fs++EtA++sl ++++    +e   ++k ++k++ kl+kn   +Lst+li+n+++ni++s+l t+lf+++++++a+++ +a++++t+
  VIMSS369699  31 LILLFLFISVIFSALETAFTSLTSFKWngyiKEHNIQKKLRTKIINKLIKNFTLTLSTILICNNVANIIISTLSTLLFNRIVENQAVGSSLAVFVTTF 128
                  567888*********************77774444444589999****************************************************** PP

        DUF21  96 lilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                  ++l+fgEi+Pks+a+ ++ k++l+++ ++ ++++l++P+++l+sk+++    + s++++se+e   +++e+++egv+e++e
  VIMSS369699 129 ITLFFGEIAPKSIAKFRPIKTVLLFSFVMIFFYYLVFPVTFLISKVFK----KYSKTQTSEKEVTFFIDEAKNEGVLENDE 205
                  ******************************************999995....5669**********************997 PP



Or compare VIMSS369699 to CDD or PaperBLAST