PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS43844 to PF01595 (DUF21)

VIMSS43844 has 412 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.4e-46  144.6  13.8    2.1e-46  143.9  13.8    1.3  1  VIMSS43844  


Domain annotation for each sequence (and alignments):
>> VIMSS43844  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.9  13.8   2.1e-46   2.1e-46       1     174 [.       5     178 ..       4     180 .. 0.95

  Alignments for each domain:
  == domain 1  score: 143.9 bits;  conditional E-value: 2.1e-46
       DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilv 99 
                 +ii+l+++lsa+fs++EtA++sls +++++ ++kg k+   +++l++ p++l++t+lign+++ni++s+l+t+++ e +  g+ a++i+t ++t+++l+
  VIMSS43844   5 IIILLFIILSAIFSASETAYTSLSIIQIQDIRKKG-KSGISVYNLVQSPSKLITTILIGNNISNIVASTLTTKFVLEKY--GNSALAISTGLITIIVLI 100
                 4666667***************************9.69999*********************************99988..689*************** PP

       DUF21 100 fgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil...esesepavseeelkklveeseeegviee 174
                 f+EilPk +a+ ++e ial ++ +l+ l+++++Pl+++++k++++il   + ++++++++e +k +++++ + g++++
  VIMSS43844 101 FAEILPKQIAILNNEIIALSTSFFLKPLIFIFTPLIYIINKIIKKILnlfKVKTSSQMTKESIKNMLSLAGSLGILKN 178
                 **************************************************9******************999998876 PP



Or compare VIMSS43844 to CDD or PaperBLAST