VIMSS43844 has 412 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-49 152.4 14.1 8.1e-49 151.8 14.1 1.3 1 VIMSS43844 Domain annotation for each sequence (and alignments): >> VIMSS43844 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.8 14.1 8.1e-49 8.1e-49 1 180 [. 5 179 .. 4 180 .. 0.95 Alignments for each domain: == domain 1 score: 151.8 bits; conditional E-value: 8.1e-49 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilv 99 +i+ll+++lsa+fsa+EtA++sls +++++ ++kg k+ +++l++ p++l++t+lign++ ni++s+l+t+++ e + g+ a++i+t+++t+++l+ VIMSS43844 5 IIILLFIILSAIFSASETAYTSLSIIQIQDIRKKG-KSGISVYNLVQSPSKLITTILIGNNISNIVASTLTTKFVLEKY--GNSALAISTGLITIIVLI 100 5677778***************************9.69999*************************************9..789*************** PP CNNM 100 fGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieee 180 f+EilPk++a+ n+e ial ++ +l+ l+++++Pl++++n++ ++il+l++v ++++++t+e ++ +++++ + G+++++ VIMSS43844 101 FAEILPKQIAILNNEIIALSTSFFLKPLIFIFTPLIYIINKIIKKILNLFKV--KTSSQMTKESIKNMLSLAGSLGILKND 179 ***********************************************99966..899***************999988765 PP
Or compare VIMSS43844 to CDD or PaperBLAST