PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS527230 to PF01595 (DUF21)

VIMSS527230 has 440 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.7e-47  146.1  10.9      7e-47  145.5  10.9    1.2  1  VIMSS527230  


Domain annotation for each sequence (and alignments):
>> VIMSS527230  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  145.5  10.9     7e-47     7e-47       3     166 ..      34     200 ..      31     206 .. 0.96

  Alignments for each domain:
  == domain 1  score: 145.5 bits;  conditional E-value: 7e-47
        DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvf 100
                  +++llllsaffs+aEt+l+sl+r ++++l ++g+k+ak ++kll++ + lLs +li+n+l+ni++sa+at + ++l   g+++++iat i+tl++lvf
  VIMSS527230  34 LIILLLLSAFFSSAETGLMSLNRYKIRHLTAQGHKGAKLAEKLLNKTDVLLSLILICNNLINIAASAIATMIGIRLA--GDTGIAIATGILTLVMLVF 129
                  57788**********************************************************************98..799**************** PP

        DUF21 101 gEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.....esesepavseeelkklvees 166
                  +EilPk++a+ y+eki+++ +++l  l +ll+Plv+l+++++++++      +++++ +s eel+++v e+
  VIMSS527230 130 SEILPKTIAVIYPEKISFLASYILTPLKKLLMPLVFLMNLIIKYLMklmriRQHEKSGLSIEELRSVVLEA 200
                  ***************************************************99*************99876 PP



Or compare VIMSS527230 to CDD or PaperBLAST