PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS52883 to PF01595 (DUF21)

VIMSS52883 has 352 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.1e-32   99.3   2.0    1.8e-32   98.6   2.0    1.3  1  VIMSS52883  


Domain annotation for each sequence (and alignments):
>> VIMSS52883  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   98.6   2.0   1.8e-32   1.8e-32       4     175 ..       9     177 ..       6     178 .. 0.95

  Alignments for each domain:
  == domain 1  score: 98.6 bits;  conditional E-value: 1.8e-32
       DUF21   4 vlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgE 102
                  + +++s ++s +E+ l+s+ ++ l +l+++g+++a+rl  l ++ +r L+++l +nt++ ++ +a a+a ++ ++  g+ ++ ++ +++tl ilv++E
  VIMSS52883   9 SVAIGVSFICSVLEAVLLSITPSYLAQLRQQGHPAANRLAGLKADIDRPLASILTLNTIAHTIGAATAGAQAAVVF--GSQWLGLFSAVLTLGILVLSE 105
                 567899**********************************************************************..58899999999********** PP

       DUF21 103 ilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieee 175
                 i+Pk++++ y  ++a   + +lr+  + l+P+vw+ +++++ +  ++ e +  ++e+ ++  +++e+g++ e 
  VIMSS52883 106 IVPKTIGATYWRELAPQASLVLRWMVWALTPFVWFSEQITKRLA-RKVEAPKLRDEISAMAMLANENGEFAEG 177
                 ********************************************.677777889**************99765 PP



Or compare VIMSS52883 to CDD or PaperBLAST